Lineage for d1erka_ (1erk A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. Protein MAP kinase Erk2 [56134] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [56136] (58 PDB entries)
  8. Domain d1erka_: 1erk A: [41657]

Details for d1erka_

PDB Entry: 1erk (more details), 2.3 Å

PDB Description: structure of signal-regulated kinase
PDB Compounds: (A:) extracellular regulated kinase 2

SCOPe Domain Sequences for d1erka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1erka_ d.144.1.7 (A:) MAP kinase Erk2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aaaaaagpemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqt
ycqrtlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsn
dhicyflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgf
lteyvatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgi
lgspsqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrie
veqalahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgyrs

SCOPe Domain Coordinates for d1erka_ are not available.

Timeline for d1erka_: