![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (5 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H3 [47122] (4 species) |
![]() | Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47123] (7 PDB entries) |
![]() | Domain d1eqzc_: 1eqz C: [16456] Other proteins in same PDB: d1eqza_, d1eqzb_, d1eqzd_, d1eqze_, d1eqzf_, d1eqzh_ |
PDB Entry: 1eqz (more details), 2.5 Å
SCOP Domain Sequences for d1eqzc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eqzc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} apatggvkkphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssa vmalqeaseaylvglfedtnlcaihakrvtimpkdiqlarrirgera
Timeline for d1eqzc_: