Lineage for d1eo8l1 (1eo8 L:1-106B)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (42 PDB entries)
Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1
Domain d1eo8l1: 1eo8 L:1-106B [20294]
Other proteins in same PDB: d1eo8a_, d1eo8b_, d1eo8h1, d1eo8h2, d1eo8h3, d1eo8l2
part of Influenza virus hemagglutinin-neutralizing Fab BH151
complexed with man, nag
Details for d1eo8l1
PDB Entry: 1eo8 (more details), 2.8 Å
PDB Description: influenza virus hemagglutinin complexed with a neutralizing antibody
PDB Compounds: (L:) antibody (light chain)SCOPe Domain Sequences for d1eo8l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eo8l1 b.1.1.1 (L:1-106B) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qiiltqspaimsaspgekvtmtcsassdisymhwyqqksdtspkiwiydtsklasgvpar
fsgsgsgtsysltistmeaedaatyychqrssyptfgggtkleik
SCOPe Domain Coordinates for d1eo8l1:
Click to download the PDB-style file with coordinates for d1eo8l1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eo8l1:
View in 3D
