| Class b: All beta proteins [48724] (177 folds) |
| Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) ![]() |
| Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins) sandwich; 9 strands in 2 sheets |
| Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species) |
| Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49491] (13 PDB entries) |
| Domain d1eo2b_: 1eo2 B: [22828] Other proteins in same PDB: d1eo2a_ complexed with fe |
PDB Entry: 1eo2 (more details), 2.25 Å
SCOPe Domain Sequences for d1eo2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eo2b_ b.3.6.1 (B:) Protocatechuate-3,4-dioxygenase, beta chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]}
iiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpkdnd
lilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigamdpn
fggcgrmltddngyyvfrtikpgpypwrnrinewrpahihfsliadgwaqrlisqfyfeg
dtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendlt
Timeline for d1eo2b_: