Lineage for d1eo2a_ (1eo2 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2379685Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2379686Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 2379709Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
    alpha and beta chains are derived from a single-chain protomer and share this fold
  7. 2379710Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49488] (6 PDB entries)
  8. 2379715Domain d1eo2a_: 1eo2 A: [22733]
    Other proteins in same PDB: d1eo2b_
    complexed with fe

Details for d1eo2a_

PDB Entry: 1eo2 (more details), 2.25 Å

PDB Description: crystal structure of acinetobacter sp. adp1 protocatechuate 3,4- dioxygenase
PDB Compounds: (A:) protocatechuate 3,4-dioxygenase alpha chain

SCOPe Domain Sequences for d1eo2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eo2a_ b.3.6.1 (A:) Protocatechuate-3,4-dioxygenase, alpha chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]}
elketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvfdglglpl
rdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikpgavpgrk
gstqaphisliifarginiglhtrvyfddeaeanakdpvlnsiewatrrqtlvakreerd
gevvyrfdiriqgenetvffdi

SCOPe Domain Coordinates for d1eo2a_:

Click to download the PDB-style file with coordinates for d1eo2a_.
(The format of our PDB-style files is described here.)

Timeline for d1eo2a_: