Lineage for d1eo2a_ (1eo2 A:)
- Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds) 
Fold b.3: Prealbumin-like [49451] (7 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strands to common fold
Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) 
Family b.3.6.1: Aromatic compound dioxygenase [49483] (4 proteins)
sandwich; 9 strands in 2 sheets
Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
alpha and beta chains are derived from a single-chain protomer and share this foldSpecies Acinetobacter calcoaceticus, adp1 [TaxId:471] [49488] (12 PDB entries) 
Domain d1eo2a_: 1eo2 A: [22733]
Other proteins in same PDB: d1eo2b_
complexed with fe
Details for d1eo2a_
PDB Entry: 1eo2 (more details), 2.25 Å
PDB Description: crystal structure of acinetobacter sp. adp1 protocatechuate 3,4- dioxygenase
PDB Compounds: (A:) protocatechuate 3,4-dioxygenase alpha chainSCOP Domain Sequences for d1eo2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eo2a_ b.3.6.1 (A:) Protocatechuate-3,4-dioxygenase, alpha chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]}
elketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvfdglglpl
rdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikpgavpgrk
gstqaphisliifarginiglhtrvyfddeaeanakdpvlnsiewatrrqtlvakreerd
gevvyrfdiriqgenetvffdi
SCOP Domain Coordinates for d1eo2a_:
Click to download the PDB-style file with coordinates for d1eo2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eo2a_:
- d1eo2a_ first appeared (with stable ids) in SCOP 1.55
- d1eo2a_ appears in SCOP 1.71
- d1eo2a_ appears in SCOP 1.75
- d1eo2a_ appears in the current release, SCOPe 2.08
View in 3D
