Lineage for d1enz__ (1enz -)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 574151Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 574152Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 574451Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (53 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 574721Protein Enoyl-ACP reductase [51791] (6 species)
  7. 574779Species Mycobacterium tuberculosis, TB, gene InhA [TaxId:1773] [51793] (6 PDB entries)
  8. 574781Domain d1enz__: 1enz - [29912]
    complexed with nad; mutant

Details for d1enz__

PDB Entry: 1enz (more details), 2.7 Å

PDB Description: crystal structure and function of the isoniazid target of mycobacterium tuberculosis

SCOP Domain Sequences for d1enz__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1enz__ c.2.1.2 (-) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA}
aglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
eldvqneehlaslagrvteaigagnkldgvvhaigfmpqtgmginpffdapyadvskgih
isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt
vcallsdwlpattgdiiyadggahtqll

SCOP Domain Coordinates for d1enz__:

Click to download the PDB-style file with coordinates for d1enz__.
(The format of our PDB-style files is described here.)

Timeline for d1enz__: