Lineage for d1em1a1 (1em1 A:1-83)
- Root: SCOPe 2.01
Class a: All alpha proteins [46456] (284 folds) 
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
2 helices; antiparallel hairpin, left-handed twistSuperfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) 
Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins) Protein Mn superoxide dismutase (MnSOD) [46618] (7 species) 
Species Human (Homo sapiens) [TaxId:9606] [46619] (27 PDB entries) 
Domain d1em1a1: 1em1 A:1-83 [15752]
Other proteins in same PDB: d1em1a2, d1em1b2
complexed with mn, so4
Details for d1em1a1
PDB Entry: 1em1 (more details), 2.13 Å
PDB Description: x-ray crystal structure for human manganese superoxide dismutase, q143a
PDB Compounds: (A:) manganese superoxide dismutaseSCOPe Domain Sequences for d1em1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1em1a1 a.2.11.1 (A:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp
SCOPe Domain Coordinates for d1em1a1:
Click to download the PDB-style file with coordinates for d1em1a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1em1a1:
- d1em1a1 first appeared (with stable ids) in SCOP 1.55
- d1em1a1 appears in SCOP 1.75
- d1em1a1 appears in SCOPe 2.02
- d1em1a1 appears in the current release, SCOPe 2.08
View in 3D
