| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.8: TPR-like [48452] (9 families) ![]() |
| Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
| Protein Hop [48456] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [48457] (3 PDB entries) |
| Domain d1elwb_: 1elw B: [19208] TPR1-domain complexed with ni, trs |
PDB Entry: 1elw (more details), 1.6 Å
SCOPe Domain Sequences for d1elwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1elwb_ a.118.8.1 (B:) Hop {Human (Homo sapiens) [TaxId: 9606]}
meqvnelkekgnkalsvgniddalqcyseaikldphnhvlysnrsaayakkgdyqkayed
gcktvdlkpdwgkgysrkaaaleflnrfeeakrtyeeglkheannpqlkeglqnm
Timeline for d1elwb_: