Class a: All alpha proteins [46456] (286 folds) |
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.8: TPR-like [48452] (9 families) |
Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
Protein Hop [48456] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [48457] (3 PDB entries) |
Domain d1elra_: 1elr A: [19209] TPR2-domain complexed with ni |
PDB Entry: 1elr (more details), 1.9 Å
SCOPe Domain Sequences for d1elra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} gkqalkekelgndaykkkdfdtalkhydkakeldptnmtyitnqaavyfekgdynkcrel cekaievgrenredyrqiakayarignsyfkeekykdaihfynkslaehrtpdvlkkcqq aekilkeq
Timeline for d1elra_: