Lineage for d1ekxa1 (1ekx A:1-150)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.78: ATC-like [53670] (2 superfamilies)
consists of two similar domains related by pseudo dyad; duplication
core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) 
Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) 
Protein Aspartate carbamoyltransferase catalytic subunit [53673] (6 species) 
Species Escherichia coli [TaxId:562] [53674] (62 PDB entries)
Uniprot P00479
Domain d1ekxa1: 1ekx A:1-150 [35088]
complexed with ca, pal
Details for d1ekxa1
PDB Entry: 1ekx (more details), 1.95 Å
PDB Description: the isolated, unregulated catalytic trimer of aspartate transcarbamoylase complexed with bisubstrate analog pala (n-(phosphonacetyl)-l-aspartate)
PDB Compounds: (A:) aspartate transcarbamoylaseSCOPe Domain Sequences for d1ekxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ekxa1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg
SCOPe Domain Coordinates for d1ekxa1:
Click to download the PDB-style file with coordinates for d1ekxa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ekxa1:
- d1ekxa1 first appeared (with stable ids) in SCOP 1.55
- d1ekxa1 appears in SCOPe 2.02
- d1ekxa1 appears in SCOPe 2.04
- d1ekxa1 appears in the current release, SCOPe 2.08
 View in 3DDomains from other chains: (mouse over for more information) d1ekxb1, d1ekxb2, d1ekxc1, d1ekxc2 |
