Lineage for d1ekta_ (1ekt A:)
- Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds) 
Fold b.129: AbrB/MazE/MraZ-like [89446] (1 superfamily)
pseudobarrel; capped on both ends by alpha-helicesSuperfamily b.129.1: AbrB/MazE/MraZ-like [89447] (3 families) 
members of this superfamily are known or predicted to have DNA-binding function
Family b.129.1.3: Transcription-state regulator AbrB, the N-terminal DNA recognition domain [54743] (1 protein)
dimeric fold similar to MazE; the DNA-binding site is similar to the conserved surface site of MraZProtein Transcription-state regulator AbrB, the N-terminal DNA recognition domain [54744] (1 species) Species Bacillus subtilis [TaxId:1423] [54745] (1 PDB entry) 
Domain d1ekta_: 1ekt A: [38764]
Details for d1ekta_
PDB Entry: 1ekt (more details)
PDB Description: solution structure of the n-terminal dna recognition domain of the bacillus subtilis transcription-state regulator abrb
SCOP Domain Sequences for d1ekta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ekta_ b.129.1.3 (A:) Transcription-state regulator AbrB, the N-terminal DNA recognition domain {Bacillus subtilis}
mkstgivrkvdelgrvvipielrrtlgiaekdaleiyvddekiilkkykpnmt
SCOP Domain Coordinates for d1ekta_:
Click to download the PDB-style file with coordinates for d1ekta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ekta_:
- d1ekta_ first appeared (with stable ids) in SCOP 1.55
- d1ekta_ appears in SCOP 1.69
- d1ekta_ does not appear in SCOP 1.73
View in 3D
