Lineage for d1ekfa_ (1ekf A:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1056766Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 1056767Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 1056768Family e.17.1.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56753] (4 proteins)
  6. 1056774Protein Branched-chain aminoacid aminotransferase [56757] (2 species)
  7. 1056794Species Human (Homo sapiens), mitochondrial [TaxId:9606] [64508] (9 PDB entries)
  8. 1056801Domain d1ekfa_: 1ekf A: [59445]
    complexed with plp

Details for d1ekfa_

PDB Entry: 1ekf (more details), 1.95 Å

PDB Description: crystallographic structure of human branched chain amino acid aminotransferase (mitochondrial) complexed with pyridoxal-5'-phosphate at 1.95 angstroms (orthorhombic form)
PDB Compounds: (A:) branched chain amino acid aminotransferase (mitochondrial)

SCOPe Domain Sequences for d1ekfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ekfa_ e.17.1.1 (A:) Branched-chain aminoacid aminotransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
asssfkaadlqlemtqkphkkpgpgeplvfgktftdhmlmvewndkgwgqpriqpfqnlt
lhpassslhyslqlfegmkafkgkdqqvrlfrpwlnmdrmlrsamrlclpsfdklellec
irrlievdkdwvpdaagtslyvrpvlignepslgvsqprrallfvilcpvgayfpggsvt
pvslladpafirawvggvgnyklggnygptvlvqqealkrgceqvlwlygpdhqltevgt
mnifvywthedgvlelvtpplngvilpgvvrqslldmaqtwgefrvvertitmkqllral
eegrvrevfgsgtacqvcpvhrilykdrnlhiptmengpelilrfqkelkeiqygirahe
wmfpv

SCOPe Domain Coordinates for d1ekfa_:

Click to download the PDB-style file with coordinates for d1ekfa_.
(The format of our PDB-style files is described here.)

Timeline for d1ekfa_: