Lineage for d1ek9a_ (1ek9 A:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2251857Fold f.5: Outer membrane efflux proteins (OEP) [56953] (1 superfamily)
    subunit fold contains tandem repeat of alpha-beta hairpin-alpha(2) motif
    trimeric fold contains barrel (n=12, S=18) formed by beta-hairpins, two from each subunit, and a bundle of helices with a channel running through it
  4. 2251858Superfamily f.5.1: Outer membrane efflux proteins (OEP) [56954] (2 families) (S)
  5. 2251859Family f.5.1.1: Outer membrane efflux proteins (OEP) [56955] (3 proteins)
    Pfam PF02321
  6. 2251860Protein Integral outer membrane protein TolC, efflux pump component [56956] (1 species)
  7. 2251861Species Escherichia coli [TaxId:562] [56957] (2 PDB entries)
    Uniprot P02930
  8. 2251862Domain d1ek9a_: 1ek9 A: [43809]

Details for d1ek9a_

PDB Entry: 1ek9 (more details), 2.1 Å

PDB Description: 2.1a x-ray structure of tolc: an integral outer membrane protein and efflux pump component from escherichia coli
PDB Compounds: (A:) outer membrane protein tolc

SCOPe Domain Sequences for d1ek9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ek9a_ f.5.1.1 (A:) Integral outer membrane protein TolC, efflux pump component {Escherichia coli [TaxId: 562]}
enlmqvyqqarlsnpelrksaadrdaafekinearspllpqlglgadytysngyrdangi
nsnatsaslqltqsifdmskwraltlqekaagiqdvtyqtdqqtlilntatayfnvlnai
dvlsytqaqkeaiyrqldqttqrfnvglvaitdvqnaraqydtvlaneltarnnldnave
qlrqitgnyypelaalnvenfktdkpqpvnallkeaekrnlsllqarlsqdlareqirqa
qdghlptldltastgisdtsysgsktrgaagtqyddsnmgqnkvglsfslpiyqggmvns
qvkqaqynfvgaseqlesahrsvvqtvrssfnninasissinaykqavvsaqssldamea
gysvgtrtivdvldatttlynakqelanarynylinqlniksalgtlneqdllalnnals
kpvstnpe

SCOPe Domain Coordinates for d1ek9a_:

Click to download the PDB-style file with coordinates for d1ek9a_.
(The format of our PDB-style files is described here.)

Timeline for d1ek9a_: