Lineage for d1ek8a_ (1ek8 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956973Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 2957018Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (2 families) (S)
    automatically mapped to Pfam PF01765
  5. 2957019Family d.67.3.1: Ribosome recycling factor, RRF [55195] (2 proteins)
  6. 2957020Protein Ribosome recycling factor, RRF [55196] (7 species)
  7. 2957023Species Escherichia coli [TaxId:562] [64292] (5 PDB entries)
  8. 2957024Domain d1ek8a_: 1ek8 A: [59444]
    complexed with dem, hg

Details for d1ek8a_

PDB Entry: 1ek8 (more details), 2.3 Å

PDB Description: crystal structure of the ribosome recycling factor (rrf) from escherichia coli
PDB Compounds: (A:) ribosome recycling factor

SCOPe Domain Sequences for d1ek8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ek8a_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Escherichia coli [TaxId: 562]}
misdirkdaevrmdkcveafktqiskirtgraspslldgivveyygtptplrqlasvtve
dsrtlkinvfdrsmspavekaimasdlglnpnsagsdirvplpplteerrkdltkivrge
aeqarvavrnvrrdandkvkallkdkeisedddrrsqddvqkltdaaikkieaaladkea
elmqf

SCOPe Domain Coordinates for d1ek8a_:

Click to download the PDB-style file with coordinates for d1ek8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ek8a_: