Lineage for d1ejxc1 (1ejx C:1002-1129,C:1423-1475)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2084271Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 2084272Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 2084273Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein)
  6. 2084274Protein alpha-Subunit of urease [51340] (4 species)
  7. 2084293Species Klebsiella aerogenes [TaxId:28451] [51341] (28 PDB entries)
  8. 2084294Domain d1ejxc1: 1ejx C:1002-1129,C:1423-1475 [83184]
    Other proteins in same PDB: d1ejxa_, d1ejxb_, d1ejxc2
    complexed with ni

Details for d1ejxc1

PDB Entry: 1ejx (more details), 1.6 Å

PDB Description: crystal structure of wild-type klebsiella aerogenes urease at 100k
PDB Compounds: (C:) urease alpha subunit

SCOPe Domain Sequences for d1ejxc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ejxc1 b.92.1.1 (C:1002-1129,C:1423-1475) alpha-Subunit of urease {Klebsiella aerogenes [TaxId: 28451]}
snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml
aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa
egkivtagXsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhy
rp

SCOPe Domain Coordinates for d1ejxc1:

Click to download the PDB-style file with coordinates for d1ejxc1.
(The format of our PDB-style files is described here.)

Timeline for d1ejxc1:

2084294
d1ejxc1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1ejxc2