Lineage for d1ejxa_ (1ejx A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1193256Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
    alpha(3)-beta(2); antiparallel hairpin
  4. 1193257Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) (S)
  5. 1193258Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein)
  6. 1193259Protein Urease, gamma-subunit [54113] (4 species)
  7. 1193273Species Klebsiella aerogenes [TaxId:28451] [54114] (27 PDB entries)
  8. 1193274Domain d1ejxa_: 1ejx A: [83182]
    Other proteins in same PDB: d1ejxb_, d1ejxc1, d1ejxc2
    complexed with ni

Details for d1ejxa_

PDB Entry: 1ejx (more details), 1.6 Å

PDB Description: crystal structure of wild-type klebsiella aerogenes urease at 100k
PDB Compounds: (A:) urease gamma subunit

SCOPe Domain Sequences for d1ejxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ejxa_ d.8.1.1 (A:) Urease, gamma-subunit {Klebsiella aerogenes [TaxId: 28451]}
meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii

SCOPe Domain Coordinates for d1ejxa_:

Click to download the PDB-style file with coordinates for d1ejxa_.
(The format of our PDB-style files is described here.)

Timeline for d1ejxa_: