Lineage for d1ejba_ (1ejb A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 981532Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 981533Superfamily c.16.1: Lumazine synthase [52121] (1 family) (S)
  5. 981534Family c.16.1.1: Lumazine synthase [52122] (2 proteins)
  6. 981535Protein Lumazine synthase [52123] (7 species)
  7. 981603Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63960] (1 PDB entry)
  8. 981604Domain d1ejba_: 1ejb A: [59417]
    complexed with inj

Details for d1ejba_

PDB Entry: 1ejb (more details), 1.85 Å

PDB Description: lumazine synthase from saccharomyces cerevisiae
PDB Compounds: (A:) lumazine synthase

SCOPe Domain Sequences for d1ejba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ejba_ c.16.1.1 (A:) Lumazine synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
avkglgkpdqvydgskirvgiiharwnrviidalvkgaiermaslgveenniiietvpgs
yelpwgtkrfvdrqaklgkpldvvipigvlikgstmhfeyisdstthalmnlqekvdmpv
ifglltcmteeqalaragideahsmhnhgedwgaaavemavkfgknaf

SCOPe Domain Coordinates for d1ejba_:

Click to download the PDB-style file with coordinates for d1ejba_.
(The format of our PDB-style files is described here.)

Timeline for d1ejba_: