Lineage for d1ej9a1 (1ej9 A:431-633,A:714-765)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
core: alpha3-beta3-alpha4; one side of beta-sheet is exposedSuperfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) 
Family d.163.1.2: Eukaryotic DNA topoisomerase I, catalytic core [56361] (1 protein) Protein Eukaryotic DNA topoisomerase I, catalytic core [56362] (2 species) Species Human (Homo sapiens) [TaxId:9606] [56363] (15 PDB entries)
Uniprot P11387 203-765 ! Uniprot P11387 203-767
Domain d1ej9a1: 1ej9 A:431-633,A:714-765 [42172]
Other proteins in same PDB: d1ej9a2
protein/DNA complex
Details for d1ej9a1
PDB Entry: 1ej9 (more details), 2.6 Å
PDB Description: crystal structure of human topoisomerase i dna complex
PDB Compounds: (A:) DNA topoisomerase ISCOPe Domain Sequences for d1ej9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ej9a1 d.163.1.2 (A:431-633,A:714-765) Eukaryotic DNA topoisomerase I, catalytic core {Human (Homo sapiens) [TaxId: 9606]}
pssrikgekdwqkyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalrag
nekeegetadtvgccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfkn
lqlfmenkqpeddlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapde
nipakilsynranravailcnhqXialgtsklnfldpritvawckkwgvpiekiynktqr
ekfawaidmadedyef
SCOPe Domain Coordinates for d1ej9a1:
Click to download the PDB-style file with coordinates for d1ej9a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ej9a1:
- d1ej9a1 first appeared (with stable ids) in SCOP 1.55
- d1ej9a1 appears in SCOPe 2.07
View in 3D
