Lineage for d1ej3a_ (1ej3 A:)
- Root: SCOP 1.73
Class a: All alpha proteins [46456] (258 folds) 
Fold a.39: EF Hand-like [47472] (4 superfamilies)
core: 4 helices; array of 2 hairpins, openedSuperfamily a.39.1: EF-hand [47473] (11 families) 
Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
Duplication: made with two pairs of EF-hands
Protein Calcium-regulated photoprotein [47512] (4 species)
structurally most similar to sarcoplasmic calcium-binding protein
Species Jellyfish (Aequorea aequorea), aequorin [TaxId:168712] [47513] (5 PDB entries) 
Domain d1ej3a_: 1ej3 A: [17259]
Details for d1ej3a_
PDB Entry: 1ej3 (more details), 2.3 Å
PDB Description: crystal structure of aequorin
PDB Compounds: (A:) aequorinSCOP Domain Sequences for d1ej3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ej3a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]}
ltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrhkdav
eaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdkdqng
aitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdpacek
lyggavp
SCOP Domain Coordinates for d1ej3a_:
Click to download the PDB-style file with coordinates for d1ej3a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ej3a_:
- d1ej3a_ first appeared (with stable ids) in SCOP 1.55
- d1ej3a_ appears in SCOP 1.71
- d1ej3a_ appears in SCOP 1.75
- d1ej3a_ appears in the current release, SCOPe 2.08
View in 3D
