SCOPe 2.04: Domain d1eiya2: 1eiy A:85-350

Lineage for d1eiya2 (1eiy A:85-350)

Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
contains large mixed beta-sheet
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
Protein Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS [55701] (1 species)
Species Thermus thermophilus [TaxId:274] [55702] (11 PDB entries)
identical sequence to Thermus aquaticus, TaxId: 271
Domain d1eiya2: 1eiy A:85-350 [40778]
Other proteins in same PDB: d1eiya1, d1eiyb1, d1eiyb2, d1eiyb3, d1eiyb4, d1eiyb5, d1eiyb6
protein/RNA complex

Details for d1eiya2

PDB Entry: 1eiy (more details), 3.3 Å

PDB Description: the crystal structure of phenylalanyl-trna synthetase from thermus thermophilus complexed with cognate trnaphe

PDB Compounds: (A:) phenylalanyl-tRNA synthetase

SCOPe Domain Sequences for d1eiya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eiya2 d.104.1.1 (A:85-350) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]}
rvdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhp
ardmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfr
feqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepg
aqfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlam
lrygipdiryffggrlkfleqfkgvl

SCOPe Domain Coordinates for d1eiya2:

Click to download the PDB-style file with coordinates for d1eiya2.
(The format of our PDB-style files is described here.)

Timeline for d1eiya2: