Lineage for d1ehib2 (1ehi B:535-770)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.142: ATP-grasp [56058] (2 superfamilies)
Consists of two subdomains with different alpha+beta folds
shares functional and structural similarities with the PIPK and protein kinase superfamiliesSuperfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) 
Family d.142.1.1: ATP-binding domain of peptide synthetases [56060] (4 proteins) 
Protein D-alanine:D-lactate ligase VanA, C-domain [56065] (2 species) Species Leuconostoc mesenteroides, Ddl2 [TaxId:1245] [56066] (1 PDB entry) 
Domain d1ehib2: 1ehi B:535-770 [41485]
Other proteins in same PDB: d1ehia1, d1ehib1
complexed with adp, mg, phy
Details for d1ehib2
PDB Entry: 1ehi (more details), 2.38 Å
PDB Description: d-alanine:d-lactate ligase (lmddl2) of vancomycin-resistant leuconostoc mesenteroides
PDB Compounds: (B:) d-alanine:d-lactate ligaseSCOPe Domain Sequences for d1ehib2:
Sequence, based on SEQRES records: (download)
>d1ehib2 d.142.1.1 (B:535-770) D-alanine:D-lactate ligase VanA, C-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]}
dkaltkelltvngirntkyivvdpesannwswdkivaelgnivfvkaanqgssvgisrvt
naeeytealsdsfqydykvlieeavngarelevgvigndqplvseigahtvpnqgsgdgw
ydynnkfvdnsavhfqipaqlspevtkevkqmaldaykvlnlrgearmdflldennvpyl
gepntlpgftnmslfkrlwdysdinnaklvdmlidygfedfaqnkklsysfvslge
Sequence, based on observed residues (ATOM records): (download)
>d1ehib2 d.142.1.1 (B:535-770) D-alanine:D-lactate ligase VanA, C-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]}
dkaltkelltvngirntkyivvdpesannwswdkivaelgnivfvkaanqgssvgisrvt
naeeytealsdsfqydykvlieeavngarelevgvigndqplvseigahtvhfqipaqls
pevtkevkqmaldaykvlnlrgearmdflldennvpylgepntlpgftnmslfkrlwdys
dinnaklvdmlidygfedfaqnkklsysfvslge
SCOPe Domain Coordinates for d1ehib2:
Click to download the PDB-style file with coordinates for d1ehib2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ehib2:
- d1ehib2 first appeared (with stable ids) in SCOP 1.55
- d1ehib2 appears in SCOPe 2.07
View in 3D
