Lineage for d1egwa_ (1egw A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963102Fold d.88: SRF-like [55454] (1 superfamily)
    alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet
  4. 2963103Superfamily d.88.1: SRF-like [55455] (2 families) (S)
  5. 2963104Family d.88.1.1: SRF-like [55456] (5 proteins)
  6. 2963109Protein Myocyte enhancer factor Mef2a core [55461] (1 species)
  7. 2963110Species Human (Homo sapiens) [TaxId:9606] [55462] (2 PDB entries)
  8. 2963111Domain d1egwa_: 1egw A: [40234]
    protein/DNA complex

Details for d1egwa_

PDB Entry: 1egw (more details), 1.5 Å

PDB Description: crystal structure of mef2a core bound to dna
PDB Compounds: (A:) mads box transcription enhancer factor 2, polypeptide a

SCOPe Domain Sequences for d1egwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egwa_ d.88.1.1 (A:) Myocyte enhancer factor Mef2a core {Human (Homo sapiens) [TaxId: 9606]}
grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
mdkvllkytey

SCOPe Domain Coordinates for d1egwa_:

Click to download the PDB-style file with coordinates for d1egwa_.
(The format of our PDB-style files is described here.)

Timeline for d1egwa_: