| Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
| Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) ![]() flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
| Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins) |
| Protein Medium chain acyl-CoA dehydrogenase, NM domains [56649] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [56651] (5 PDB entries) Uniprot P11310 34-421 |
| Domain d1egda2: 1egd A:10-241 [42857] Other proteins in same PDB: d1egda1, d1egdb1, d1egdc1, d1egdd1 complexed with fad; mutant |
PDB Entry: 1egd (more details), 2.4 Å
SCOPe Domain Sequences for d1egda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1egda2 e.6.1.1 (A:10-241) Medium chain acyl-CoA dehydrogenase, NM domains {Human (Homo sapiens) [TaxId: 9606]}
lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligd
Timeline for d1egda2: