SCOP 1.75: Domain d1egca2: 1egc A:10-241

Lineage for d1egca2 (1egc A:10-241)

Root: SCOP 1.75
Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (2 families)
flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (9 proteins)
Protein Medium chain acyl-CoA dehydrogenase, NM domains [56649] (3 species)
Species Human (Homo sapiens) [TaxId:9606] [56651] (5 PDB entries)
Uniprot P11310 34-421
Domain d1egca2: 1egc A:10-241 [42861]
Other proteins in same PDB: d1egca1, d1egcb1, d1egcc1, d1egcd1

Details for d1egca2

PDB Entry: 1egc (more details), 2.6 Å

PDB Description: structure of t255e, e376g mutant of human medium chain acyl-coa dehydrogenase complexed with octanoyl-coa

PDB Compounds: (A:) medium chain acyl-coa dehydrogenase

SCOP Domain Sequences for d1egca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egca2 e.6.1.1 (A:10-241) Medium chain acyl-CoA dehydrogenase, NM domains {Human (Homo sapiens) [TaxId: 9606]}
lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligd

SCOP Domain Coordinates for d1egca2:

Click to download the PDB-style file with coordinates for d1egca2.
(The format of our PDB-style files is described here.)

Timeline for d1egca2: