Lineage for d1egab2 (1ega B:183-296)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1025652Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 1025679Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 1025680Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)
  6. 1025681Protein GTPase Era C-terminal domain [54818] (2 species)
  7. 1025682Species Escherichia coli [TaxId:562] [54819] (3 PDB entries)
  8. 1025684Domain d1egab2: 1ega B:183-296 [38837]
    Other proteins in same PDB: d1egaa1, d1egab1
    complexed with so4

Details for d1egab2

PDB Entry: 1ega (more details), 2.4 Å

PDB Description: crystal structure of a widely conserved gtpase era
PDB Compounds: (B:) protein (GTP-binding protein era)

SCOPe Domain Sequences for d1egab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egab2 d.52.3.1 (B:183-296) GTPase Era C-terminal domain {Escherichia coli [TaxId: 562]}
dyitdrsqrfmaseiireklmrflgaelpysvtveierfvsnerggydinglilveregq
kkmvignkgakiktigiearkdmqemfeapvhlelwvkvksgwadderalrslg

SCOPe Domain Coordinates for d1egab2:

Click to download the PDB-style file with coordinates for d1egab2.
(The format of our PDB-style files is described here.)

Timeline for d1egab2:

1025684
d1egab2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1egab1