Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein GTPase Era, N-terminal domain [52637] (2 species) |
Species Escherichia coli [TaxId:562] [52638] (3 PDB entries) |
Domain d1egaa1: 1ega A:4-182 [32150] Other proteins in same PDB: d1egaa2, d1egab2 complexed with so4 |
PDB Entry: 1ega (more details), 2.4 Å
SCOPe Domain Sequences for d1egaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} dksycgfiaivgrpnvgkstllnkllgqkisitsrkaqttrhrivgihtegayqaiyvdt pglhmeekrainrlmnkaasssigdvelvifvvegtrwtpddemvlnklregkapvilav nkvdnvqekadllphlqflasqmnfldivpisaetglnvdtiaaivrkhlpeathhfpe
Timeline for d1egaa1: