| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
| Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (6 proteins) Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1 |
| Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (5 species) |
| Species Pseudomonas putida [TaxId:303] [55971] (10 PDB entries) |
| Domain d1eg9a2: 1eg9 A:155-447 [41322] Other proteins in same PDB: d1eg9a1, d1eg9b_ complexed with fe, fes, ind, so4 |
PDB Entry: 1eg9 (more details), 1.6 Å
SCOPe Domain Sequences for d1eg9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eg9a2 d.129.3.3 (A:155-447) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Pseudomonas putida [TaxId: 303]}
eapplmdylgdaawylepmfkhsgglelvgppgkvvikanwkapaenfvgdayhvgwtha
sslrsgesifsslagnaalppegaglqmtskygsgmgvlwdgysgvhsadlvpelmafgg
akqerlnkeigdvrariyrshlnctvfpnnsmltcsgvfkvwnpidanttevwtyaivek
dmpedlkrrladsvqrtfgpagfwesddndnmetasqngkkyqsrdsdllsnlgfgedvy
gdavypgvvgksaigetsyrgfyrayqahvsssnwaefehasstwhteltktt
Timeline for d1eg9a2: