Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
Species Human (Homo sapiens), HLA-CW3 [TaxId:9606] [54477] (2 PDB entries) |
Domain d1efxa2: 1efx A:1-181 [38273] Other proteins in same PDB: d1efxa1, d1efxb2, d1efxb3, d1efxd1, d1efxd2, d1efxe1, d1efxe2 |
PDB Entry: 1efx (more details), 3 Å
SCOPe Domain Sequences for d1efxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efxa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-CW3 [TaxId: 9606]} gshsmryfytavsrpgrgephfiavgyvddtqfvrfdsdaasprgeprapwveqegpeyw dretqkykrqaqtdrvslrnlrgyynqseagshiiqrmygcdvgpdgrllrgydqyaydg kdyialnedlrswtaadtaaqitqrkweaareaeqlrayleglcvewlrrylkngketlq r
Timeline for d1efxa2: