Lineage for d1efvb_ (1efv B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861263Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2861418Family c.26.2.3: ETFP subunits [52432] (3 proteins)
    alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet
  6. 2861440Protein Small, beta subunit of electron transfer flavoprotein ETFP [81394] (3 species)
    binds AMP
  7. 2861441Species Human (Homo sapiens) [TaxId:9606] [81390] (3 PDB entries)
    Uniprot P38117
  8. 2861442Domain d1efvb_: 1efv B: [31634]
    Other proteins in same PDB: d1efva1, d1efva2
    complexed with amp, fad

Details for d1efvb_

PDB Entry: 1efv (more details), 2.1 Å

PDB Description: three-dimensional structure of human electron transfer flavoprotein to 2.1 a resolution
PDB Compounds: (B:) electron transfer flavoprotein

SCOPe Domain Sequences for d1efvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efvb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Human (Homo sapiens) [TaxId: 9606]}
lrvlvavkrvidyavkirvkpdrtgvvtdgvkhsmnpfceiaveeavrlkekklvkevia
vscgpaqcqetirtalamgadrgihvevppaeaerlgplqvarvlaklaekekvdlvllg
kqaidddcnqtgqmtagfldwpqgtfasqvtlegdklkvereidggletlrlklpavvta
dlrlnepryatlpnimkakkkkievikpgdlgvdltsklsvisvedppqrtagvkvette
dlvaklkeigri

SCOPe Domain Coordinates for d1efvb_:

Click to download the PDB-style file with coordinates for d1efvb_.
(The format of our PDB-style files is described here.)

Timeline for d1efvb_: