Lineage for d1efva2 (1efv A:208-331)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-likeSuperfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) 
binds cofactor molecules in the opposite direction than classical Rossmann fold
Family c.31.1.2: C-terminal domain of the electron transfer flavoprotein alpha subunit [52471] (1 protein)
lacks strand 3; shares the FAD-binding mode with the pyruvate oxidase domainProtein C-terminal domain of the electron transfer flavoprotein alpha subunit [52472] (3 species) Species Human (Homo sapiens) [TaxId:9606] [52473] (1 PDB entry) 
Domain d1efva2: 1efv A:208-331 [31728]
Other proteins in same PDB: d1efva1, d1efvb_
complexed with amp, fad
Details for d1efva2
PDB Entry: 1efv (more details), 2.1 Å
PDB Description: three-dimensional structure of human electron transfer flavoprotein to 2.1 a resolution
PDB Compounds: (A:) electron transfer flavoproteinSCOPe Domain Sequences for d1efva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efva2 c.31.1.2 (A:208-331) C-terminal domain of the electron transfer flavoprotein alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
drpeltgakvvvsggrglksgenfkllydladqlhaavgasraavdagfvpndmqvgqtg
kivapelyiavgisgaiqhlagmkdsktivainkdpeapifqvadygivadlfkvvpemt
eilk
SCOPe Domain Coordinates for d1efva2:
Click to download the PDB-style file with coordinates for d1efva2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1efva2:
- d1efva2 first appeared (with stable ids) in SCOP 1.55
- d1efva2 appears in SCOPe 2.07
View in 3D
