Lineage for d1efva1 (1efv A:20-207)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (6 families) 
share similar mode of ligand (Adenosine group) binding
can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
Family c.26.2.3: ETFP subunits [52432] (2 proteins)
alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet
Protein Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain [81393] (3 species)
contains an additional FAD-binding domain of DHS-like fold
Species Human (Homo sapiens) [TaxId:9606] [81389] (4 PDB entries)
Uniprot P13804 20-203
Domain d1efva1: 1efv A:20-207 [31633]
Other proteins in same PDB: d1efva2, d1efvb_
complexed with amp, fad
Details for d1efva1
PDB Entry: 1efv (more details), 2.1 Å
PDB Description: three-dimensional structure of human electron transfer flavoprotein to 2.1 a resolution
PDB Compounds: (A:) electron transfer flavoproteinSCOP Domain Sequences for d1efva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efva1 c.26.2.3 (A:20-207) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
qstlviaehandslapitlntitaatrlggevsclvagtkcdkvaqdlckvagiakvlva
qhdvykgllpeeltplilatqkqfnythicagasafgknllprvaaklevapisdiiaik
spdtfvrtiyagnalctvkcdekvkvfsvrgtsfdaaatsggsassekasstspveisew
ldqkltks
SCOP Domain Coordinates for d1efva1:
Click to download the PDB-style file with coordinates for d1efva1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1efva1:
- d1efva1 first appeared (with stable ids) in SCOP 1.55
- d1efva1 appears in SCOP 1.73
- d1efva1 appears in SCOPe 2.01
- d1efva1 appears in the current release, SCOPe 2.08
View in 3D
