Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (6 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.3: ETFP subunits [52432] (2 proteins) alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet |
Protein Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain [81393] (3 species) contains an additional FAD-binding domain of DHS-like fold |
Species Human (Homo sapiens) [TaxId:9606] [81389] (4 PDB entries) Uniprot P13804 20-203 |
Domain d1efva1: 1efv A:20-207 [31633] Other proteins in same PDB: d1efva2, d1efvb_ complexed with amp, fad |
PDB Entry: 1efv (more details), 2.1 Å
SCOP Domain Sequences for d1efva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efva1 c.26.2.3 (A:20-207) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} qstlviaehandslapitlntitaatrlggevsclvagtkcdkvaqdlckvagiakvlva qhdvykgllpeeltplilatqkqfnythicagasafgknllprvaaklevapisdiiaik spdtfvrtiyagnalctvkcdekvkvfsvrgtsfdaaatsggsassekasstspveisew ldqkltks
Timeline for d1efva1: