Lineage for d1efga1 (1efg A:283-403)
- Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds) 
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
barrel, closed; n=6, S=10; greek-key
Superfamily b.43.3: Translation proteins [50447] (6 families) 
Family b.43.3.1: Elongation factors [50448] (10 proteins) 
Protein Elongation factor G (EF-G), domain II [50456] (2 species) 
Species Thermus thermophilus [TaxId:274] [50457] (9 PDB entries) 
Domain d1efga1: 1efg A:283-403 [25711]
Other proteins in same PDB: d1efga2, d1efga3, d1efga4
complexed with gdp
Details for d1efga1
PDB Entry: 1efg (more details), 2.7 Å
PDB Description: the crystal structure of elongation factor g complexed with gdp, at 2.7 angstroms resolution
PDB Compounds: (A:) Elongation factor GSCOP Domain Sequences for d1efga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efga1 b.43.3.1 (A:283-403) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]}
pldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvy
nttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvgedaprvilesi
e
SCOP Domain Coordinates for d1efga1:
Click to download the PDB-style file with coordinates for d1efga1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1efga1:
- d1efga1 first appeared (with stable ids) in SCOP 1.55
- d1efga1 appears in SCOP 1.73
- d1efga1 appears in SCOPe 2.01
- d1efga1 appears in the current release, SCOPe 2.08
View in 3D
