Class b: All beta proteins [48724] (165 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (5 families) |
Family b.43.3.1: Elongation factors [50448] (10 proteins) |
Protein Elongation factor G (EF-G), domain II [50456] (2 species) |
Species Thermus thermophilus [TaxId:274] [50457] (9 PDB entries) |
Domain d1efga1: 1efg A:283-403 [25711] Other proteins in same PDB: d1efga2, d1efga3, d1efga4 complexed with gdp |
PDB Entry: 1efg (more details), 2.7 Å
SCOP Domain Sequences for d1efga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efga1 b.43.3.1 (A:283-403) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]} pldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvy nttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvgedaprvilesi e
Timeline for d1efga1: