Lineage for d1ecra_ (1ecr A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618340Fold e.2: Replication terminator protein (Tus) [56595] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 2618341Superfamily e.2.1: Replication terminator protein (Tus) [56596] (1 family) (S)
    automatically mapped to Pfam PF05472
  5. 2618342Family e.2.1.1: Replication terminator protein (Tus) [56597] (1 protein)
  6. 2618343Protein Replication terminator protein (Tus) [56598] (1 species)
  7. 2618344Species Escherichia coli [TaxId:562] [56599] (4 PDB entries)
  8. 2618346Domain d1ecra_: 1ecr A: [42678]
    protein/DNA complex

Details for d1ecra_

PDB Entry: 1ecr (more details), 2.7 Å

PDB Description: escherichia coli replication terminator protein (tus) complexed with dna
PDB Compounds: (A:) protein (replication-terminator protein)

SCOPe Domain Sequences for d1ecra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ecra_ e.2.1.1 (A:) Replication terminator protein (Tus) {Escherichia coli [TaxId: 562]}
dlvdrlnttfrqmeqelaifaahleqhkllvarvfslpevkkedehnplnrievkqhlgn
daqslalrhfrhlfiqqqsenrsskaavrlpgvlcyqvdnlsqaalvshiqhinklkttf
ehivtveselptaarfewvhrhlpglitlnayrtltvlhdpatlrfgwankhiiknlhrd
evlaqlekslksprsvapwtreewqrklereyqdiaalpqnaklkikrpvkvqpiarvwy
kgdqkqvqhacptplialinrdngagvpdvgellnydadnvqhrykpqaqplrliiprlh
lyvad

SCOPe Domain Coordinates for d1ecra_:

Click to download the PDB-style file with coordinates for d1ecra_.
(The format of our PDB-style files is described here.)

Timeline for d1ecra_: