Lineage for d1ec6a_ (1ec6 A:)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/betaSuperfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) 
Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
an RNA-binding domain
Protein Neuro-oncological ventral antigen 2, nova-2, KH3 [54795] (1 species) Species Human (Homo sapiens) [TaxId:9606] [54796] (2 PDB entries) 
Domain d1ec6a_: 1ec6 A: [38804]
protein/RNA complex
Details for d1ec6a_
PDB Entry: 1ec6 (more details), 2.4 Å
PDB Description: crystal structure of nova-2 kh3 k-homology rna-binding domain bound to 20-mer rna hairpin
PDB Compounds: (A:) RNA-binding protein nova-2SCOPe Domain Sequences for d1ec6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ec6a_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]}
mkelveiavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa
atqaaqylisqrvtyeqgvrasnpqkv
SCOPe Domain Coordinates for d1ec6a_:
Click to download the PDB-style file with coordinates for d1ec6a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ec6a_:
- d1ec6a_ first appeared (with stable ids) in SCOP 1.55
- d1ec6a_ appears in SCOPe 2.02
- d1ec6a_ appears in SCOPe 2.04
- d1ec6a_ appears in the current release, SCOPe 2.08, called d1ec6a1
View in 3D
