Lineage for d1ebof_ (1ebo F:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1970302Superfamily h.3.2: Virus ectodomain [58069] (2 families) (S)
  5. 1970303Family h.3.2.1: Virus ectodomain [58070] (9 proteins)
  6. 1970304Protein Core structure of Ebo gp2 [58076] (1 species)
  7. 1970305Species Ebola virus [TaxId:205488] [58077] (2 PDB entries)
  8. 1970314Domain d1ebof_: 1ebo F: [45762]
    chimeric, contains a fragment of gcn4 zipper at the N-terminus (res. 1-29)
    complexed with cl, zn

Details for d1ebof_

PDB Entry: 1ebo (more details), 3 Å

PDB Description: crystal structure of the ebola virus membrane-fusion subunit, gp2, from the envelope glycoprotein ectodomain
PDB Compounds: (F:) ebola virus envelope protein chimera consisting of a fragment of gcn4 zipper cloned n-terminal to a fragment of gp2

SCOPe Domain Sequences for d1ebof_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebof_ h.3.2.1 (F:) Core structure of Ebo gp2 {Ebola virus [TaxId: 205488]}
qiedkieeilskiyhieneiarikkligeadglieglrqlanettqalqlflrattelrt
fsilnrkaidfllqrwggtchilgpdcriephdwtknitdkidqiihdfvdkt

SCOPe Domain Coordinates for d1ebof_:

Click to download the PDB-style file with coordinates for d1ebof_.
(The format of our PDB-style files is described here.)

Timeline for d1ebof_: