Lineage for d1ebma2 (1ebm A:9-135)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.129: TBP-like [55944] (11 superfamilies)
beta-alpha-beta(4)-alpha
Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) 
Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (3 proteins)
contains a single copy of this fold
Protein 8-oxoguanine glycosylase [55955] (1 species) Species Human (Homo sapiens) [TaxId:9606] [55956] (24 PDB entries) 
Domain d1ebma2: 1ebm A:9-135 [41300]
Other proteins in same PDB: d1ebma1
protein/DNA complex; complexed with ca
Details for d1ebma2
PDB Entry: 1ebm (more details), 2.1 Å
PDB Description: crystal structure of the human 8-oxoguanine glycosylase (hogg1) bound to a substrate oligonucleotide
PDB Compounds: (A:) 8-oxoguanine DNA glycosylaseSCOPe Domain Sequences for d1ebma2:
Sequence, based on SEQRES records: (download)
>d1ebma2 d.129.1.2 (A:9-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
gseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
teeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfq
gvrllrq
Sequence, based on observed residues (ATOM records): (download)
>d1ebma2 d.129.1.2 (A:9-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
gseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
teeqlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
llrq
SCOPe Domain Coordinates for d1ebma2:
Click to download the PDB-style file with coordinates for d1ebma2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ebma2:
- d1ebma2 first appeared (with stable ids) in SCOP 1.55
- d1ebma2 appears in SCOPe 2.07
View in 3D
