Lineage for d1ebma1 (1ebm A:136-325)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334077Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2334078Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2334119Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins)
  6. 2334160Protein 8-oxoguanine glycosylase [48160] (1 species)
  7. 2334161Species Human (Homo sapiens) [TaxId:9606] [48161] (24 PDB entries)
  8. 2334166Domain d1ebma1: 1ebm A:136-325 [18751]
    Other proteins in same PDB: d1ebma2
    protein/DNA complex; complexed with ca

Details for d1ebma1

PDB Entry: 1ebm (more details), 2.1 Å

PDB Description: crystal structure of the human 8-oxoguanine glycosylase (hogg1) bound to a substrate oligonucleotide
PDB Compounds: (A:) 8-oxoguanine DNA glycosylase

SCOPe Domain Sequences for d1ebma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebma1 a.96.1.3 (A:136-325) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
dpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah
lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtqvadcic
lmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpyagwaq
avlfsadlrq

SCOPe Domain Coordinates for d1ebma1:

Click to download the PDB-style file with coordinates for d1ebma1.
(The format of our PDB-style files is described here.)

Timeline for d1ebma1: