Lineage for d1ebga2 (1ebg A:1-141)
- Root: SCOPe 2.02
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
beta(3)-alpha(3); meander and up-and-down bundleSuperfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) 
Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
C-terminal domain is beta/alpha-barrel
Protein Enolase [54828] (8 species) 
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (16 PDB entries) 
Domain d1ebga2: 1ebg A:1-141 [38853]
Other proteins in same PDB: d1ebga1, d1ebgb1
complexed with mg, pah
Details for d1ebga2
PDB Entry: 1ebg (more details), 2.1 Å
PDB Description: chelation of ser 39 to mg2+ latches a gate at the active site of enolase: structure of the bis(mg2+) complex of yeast enolase and the intermediate analog phosphonoacetohydroxamate at 2.1 angstroms resolution
PDB Compounds: (A:) enolaseSCOPe Domain Sequences for d1ebga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ebga2 d.54.1.1 (A:1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlskskt
SCOPe Domain Coordinates for d1ebga2:
Click to download the PDB-style file with coordinates for d1ebga2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ebga2:
- d1ebga2 first appeared (with stable ids) in SCOP 1.55
- d1ebga2 appears in SCOPe 2.01
- d1ebga2 appears in SCOPe 2.03
- d1ebga2 appears in the current release, SCOPe 2.08
View in 3D
