Lineage for d1eb7a1 (1eb7 A:1-164)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.3: Cytochrome c [46625] (1 superfamily)
core: 3 helices; folded leaf, openedSuperfamily a.3.1: Cytochrome c [46626] (9 families) 
covalently-bound heme completes the core
Family a.3.1.5: Di-heme cytochrome c peroxidase [46685] (1 protein)
duplication: contains two cytochrome c-type domainsProtein Di-heme cytochrome c peroxidase [46686] (3 species) Species Pseudomonas aeruginosa [TaxId:287] [46687] (2 PDB entries) 
Domain d1eb7a1: 1eb7 A:1-164 [59404]
complexed with ca, hec
Details for d1eb7a1
PDB Entry: 1eb7 (more details), 2.4 Å
PDB Description: crystal structure of the di-haem cytochrome c peroxidase from pseudomonas aeruginosa
PDB Compounds: (A:) cytochrome c551 peroxidaseSCOPe Domain Sequences for d1eb7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eb7a1 a.3.1.5 (A:1-164) Di-heme cytochrome c peroxidase {Pseudomonas aeruginosa [TaxId: 287]}
dalhdqasalfkpipeqvtelrgqpiseqqrelgkklffdprlsrshvlscntchnvgtg
gadnvptsvghgwqkgprnsptvfnavfnaaqfwdgrakdlgeqakgpiqnsvemhstpq
lveqtlgsipeyvdafrkafpkagkpvsfdnmalaieayeatlv
SCOPe Domain Coordinates for d1eb7a1:
Click to download the PDB-style file with coordinates for d1eb7a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eb7a1:
- d1eb7a1 first appeared in SCOP 1.57
- d1eb7a1 appears in SCOPe 2.07
View in 3D
