Lineage for d1eaza_ (1eaz A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1550800Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1550801Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1550802Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 1551031Protein Tapp1 [74993] (1 species)
  7. 1551032Species Human (Homo sapiens) [TaxId:9606] [74994] (1 PDB entry)
  8. 1551033Domain d1eaza_: 1eaz A: [70113]
    phosphoinositol (3,4)-bisphosphate binding PH domain
    complexed with cit

Details for d1eaza_

PDB Entry: 1eaz (more details), 1.4 Å

PDB Description: crystal structure of the phosphoinositol (3,4)-bisphosphate binding ph domain of tapp1 from human.
PDB Compounds: (A:) tandem ph domain containing protein-1

SCOPe Domain Sequences for d1eaza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]}
savikagycvkqgavmknwkrryfqldentigyfkselekeplrviplkevhkvqeckqs
dimmrdnlfeivttsrtfyvqadspeemhswikavsgaivaqrg

SCOPe Domain Coordinates for d1eaza_:

Click to download the PDB-style file with coordinates for d1eaza_.
(The format of our PDB-style files is described here.)

Timeline for d1eaza_: