Lineage for d1eara2 (1ear A:75-142)
- Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.38: Urease metallochaperone UreE, C-terminal domain [69737] (1 family) 
Family d.58.38.1: Urease metallochaperone UreE, C-terminal domain [69738] (1 protein) Protein Urease metallochaperone UreE, C-terminal domain [69739] (2 species) 
Species Bacillus pasteurii [TaxId:1474] [69741] (2 PDB entries) 
Domain d1eara2: 1ear A:75-142 [64876]
Other proteins in same PDB: d1eara1
complexed with zn; mutant
Details for d1eara2
PDB Entry: 1ear (more details), 1.7 Å
PDB Description: crystal structure of bacillus pasteurii uree at 1.7 a. type ii crystal form.
PDB Compounds: (A:) urease accessory protein ureeSCOP Domain Sequences for d1eara2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eara2 d.58.38.1 (A:75-142) Urease metallochaperone UreE, C-terminal domain {Bacillus pasteurii [TaxId: 1474]}
lekvyvikpqtmqemgkmafeignrhtmciieddeilvrydktleklidevgvsyeqser
rfkepfky
SCOP Domain Coordinates for d1eara2:
Click to download the PDB-style file with coordinates for d1eara2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eara2:
- d1eara2 first appeared in SCOP 1.59
- d1eara2 appears in SCOP 1.73
- d1eara2 appears in SCOPe 2.01
- d1eara2 appears in the current release, SCOPe 2.08
View in 3D
