![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.8: TPR-like [48452] (8 families) ![]() |
![]() | Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (17 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
![]() | Protein Neutrophil cytosolic factor 2 (NCF-2, p67-phox) [48460] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48461] (3 PDB entries) |
![]() | Domain d1e96b_: 1e96 B: [19211] Other proteins in same PDB: d1e96a_ complexed with gtp, mg; mutant |
PDB Entry: 1e96 (more details), 2.4 Å
SCOP Domain Sequences for d1e96b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e96b_ a.118.8.1 (B:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} slveaislwnegvlaadkkdwkgaldafsavqdphsricfnigcmytilknmteaekaft rsinrdkhlavayfqrgmlyyqtekydlaikdlkealiqlrgnqlidykilglqfklfac evlyniafmyakkeewkkaeeqlalatsmkseprhskidkamecvwkqklyepvvipvgk lfrpn
Timeline for d1e96b_: