Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein HslV (ClpQ) protease [56258] (4 species) dodecameric prokaryotic homologue of proteasome |
Species Escherichia coli [TaxId:562] [56259] (8 PDB entries) |
Domain d1e94a_: 1e94 A: [41977] Other proteins in same PDB: d1e94e_, d1e94f_ complexed with anp |
PDB Entry: 1e94 (more details), 2.8 Å
SCOPe Domain Sequences for d1e94a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e94a_ d.153.1.4 (A:) HslV (ClpQ) protease {Escherichia coli [TaxId: 562]} ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
Timeline for d1e94a_: