Lineage for d1e8ob_ (1e8o B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946817Fold d.49: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54761] (1 superfamily)
    (beta)-alpha-beta(3)-alpha; 2 layers, alpha/beta
  4. 2946818Superfamily d.49.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54762] (2 families) (S)
  5. 2946819Family d.49.1.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54763] (2 proteins)
  6. 2946820Protein Signal recognition particle 14KDa protein, SRP14 [88848] (2 species)
  7. 2946821Species Human (Homo sapiens) [TaxId:9606] [88849] (2 PDB entries)
  8. 2946822Domain d1e8ob_: 1e8o B: [38775]
    Other proteins in same PDB: d1e8oa_, d1e8oc_
    complexed with so4

Details for d1e8ob_

PDB Entry: 1e8o (more details), 3.2 Å

PDB Description: core of the alu domain of the mammalian srp
PDB Compounds: (B:) signal recognition particle 14 kda protein

SCOPe Domain Sequences for d1e8ob_:

Sequence, based on SEQRES records: (download)

>d1e8ob_ d.49.1.1 (B:) Signal recognition particle 14KDa protein, SRP14 {Human (Homo sapiens) [TaxId: 9606]}
vlleseqflteltrlfqkcrtsgsvyitlkkydgrtkpipkkgtvegfepadnkcllrat
dgkkkistvvsskevnkfqmaysnllranmdglk

Sequence, based on observed residues (ATOM records): (download)

>d1e8ob_ d.49.1.1 (B:) Signal recognition particle 14KDa protein, SRP14 {Human (Homo sapiens) [TaxId: 9606]}
vlleseqflteltrlfqkcrtsgsvyitlkkydnkcllratdgkkkistvvsskevnkfq
maysnllranmdglk

SCOPe Domain Coordinates for d1e8ob_:

Click to download the PDB-style file with coordinates for d1e8ob_.
(The format of our PDB-style files is described here.)

Timeline for d1e8ob_: