Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
Family f.21.2.1: Fumarate reductase respiratory complex cytochrome b subunit, FrdC [56910] (2 proteins) duplication: consists of two structural repeats; the heme-binding sites are related by pseudo two fold symmetry |
Protein Fumarate reductase respiratory complex cytochrome b subunit, FrdC [56911] (1 species) |
Species Wolinella succinogenes [TaxId:844] [56913] (5 PDB entries) |
Domain d1e7pc_: 1e7p C: [59352] Other proteins in same PDB: d1e7pa1, d1e7pa2, d1e7pa3, d1e7pb1, d1e7pb2, d1e7pd1, d1e7pd2, d1e7pd3, d1e7pe1, d1e7pe2, d1e7pg1, d1e7pg2, d1e7pg3, d1e7ph1, d1e7ph2, d1e7pj1, d1e7pj2, d1e7pj3, d1e7pk1, d1e7pk2 complexed with f3s, fad, fes, hem, lmt, mla, na, sf4 |
PDB Entry: 1e7p (more details), 3.1 Å
SCOPe Domain Sequences for d1e7pc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e7pc_ f.21.2.1 (C:) Fumarate reductase respiratory complex cytochrome b subunit, FrdC {Wolinella succinogenes [TaxId: 844]} mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw vtkkfqldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfave lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd pnidykyfdykrth
Timeline for d1e7pc_: