Lineage for d1e7pb2 (1e7p B:1-106)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) 
Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) 
Protein Fumarate reductase iron-sulfur protein, N-terminal domain [54325] (3 species) Species Wolinella succinogenes [TaxId:844] [54327] (5 PDB entries) 
Domain d1e7pb2: 1e7p B:1-106 [59351]
Other proteins in same PDB: d1e7pa1, d1e7pa2, d1e7pa3, d1e7pb1, d1e7pc_, d1e7pd1, d1e7pd2, d1e7pd3, d1e7pe1, d1e7pf_, d1e7pg1, d1e7pg2, d1e7pg3, d1e7ph1, d1e7pi_, d1e7pj1, d1e7pj2, d1e7pj3, d1e7pk1, d1e7pl_
complexed with f3s, fad, fes, hem, lmt, mla, na, sf4
Details for d1e7pb2
PDB Entry: 1e7p (more details), 3.1 Å
PDB Description: quinol:fumarate reductase from wolinella succinogenes
PDB Compounds: (B:) fumarate reductase iron-sulfur proteinSCOPe Domain Sequences for d1e7pb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e7pb2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]}
mgrmltirvfkydpqsavskphfqeykieeapsmtifivlnmiretydpdlnfdfvcrag
icgscgmmingrpslacrtltkdfedgvitllplpafklikdlsvd
SCOPe Domain Coordinates for d1e7pb2:
Click to download the PDB-style file with coordinates for d1e7pb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e7pb2:
- d1e7pb2 first appeared in SCOP 1.57
- d1e7pb2 appears in SCOPe 2.06
- d1e7pb2 appears in the current release, SCOPe 2.08
View in 3D
