Lineage for d1e7la1 (1e7l A:104-157)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734562Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 2734657Superfamily a.140.4: Recombination endonuclease VII, C-terminal and dimerization domains [68918] (1 family) (S)
    automatically mapped to Pfam PF09124
  5. 2734658Family a.140.4.1: Recombination endonuclease VII, C-terminal and dimerization domains [68919] (1 protein)
  6. 2734659Protein Recombination endonuclease VII, C-terminal and dimerization domains [68920] (1 species)
  7. 2734660Species Bacteriophage T4 [TaxId:10665] [54074] (5 PDB entries)
  8. 2734661Domain d1e7la1: 1e7l A:104-157 [64728]
    Other proteins in same PDB: d1e7la2, d1e7lb2
    complexed with so4, zn; mutant

Details for d1e7la1

PDB Entry: 1e7l (more details), 1.32 Å

PDB Description: endonuclease vii (endovii) n62d mutant from phage t4
PDB Compounds: (A:) recombination endonuclease vii

SCOPe Domain Sequences for d1e7la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7la1 a.140.4.1 (A:104-157) Recombination endonuclease VII, C-terminal and dimerization domains {Bacteriophage T4 [TaxId: 10665]}
ihpnfvgdkskefsrlgkeemmaemlqrgfeynesdtktqliasfkkqlrkslk

SCOPe Domain Coordinates for d1e7la1:

Click to download the PDB-style file with coordinates for d1e7la1.
(The format of our PDB-style files is described here.)

Timeline for d1e7la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e7la2