Lineage for d1e7ka_ (1e7k A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2566728Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 2566729Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 2566830Protein Spliceosomal 15.5kd protein [55321] (1 species)
  7. 2566831Species Human (Homo sapiens) [TaxId:9606] [55322] (3 PDB entries)
  8. 2566832Domain d1e7ka_: 1e7k A: [39813]

Details for d1e7ka_

PDB Entry: 1e7k (more details), 2.9 Å

PDB Description: crystal structure of the spliceosomal 15.5kd protein bound to a u4 snrna fragment
PDB Compounds: (A:) 15.5 kd RNA binding protein

SCOPe Domain Sequences for d1e7ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7ka_ d.79.3.1 (A:) Spliceosomal 15.5kd protein {Human (Homo sapiens) [TaxId: 9606]}
advnpkaypladahltkklldlvqqscnykqlrkganeatktlnrgisefivmaadaepl
eiilhlpllcedknvpyvfvrskqalgracgvsrpviacsvtikegsqlkqqiqsiqqsi
erllv

SCOPe Domain Coordinates for d1e7ka_:

Click to download the PDB-style file with coordinates for d1e7ka_.
(The format of our PDB-style files is described here.)

Timeline for d1e7ka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1e7kb_